General Information

  • ID:  hor000032
  • Uniprot ID:  O44664(23-73)
  • Protein name:  Neuropeptide-like protein 29
  • Gene name:  nlp-29
  • Organism:  Caenorhabditis elegans
  • Family:  YARP (YGGW-amide related peptide) family
  • Source:  animal
  • Expression:  Upon D.coniospora and S.marcescens infection . |Weakly or not expressed in absence of infection. Upon infection by D.coniospora, it is expressed in hypoderm. Also expressed in perivulval cells when D.coniospora spores adhere to this region .
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Caenorhabditis (genus), Peloderinae (subfamily), Rhabditidae (family), Rhabditoidea (superfamily), Rhabditomorpha (infraorder), Rhabditina (suborder), Rhabditida (order), Chromadorea (class), Nematoda (phylum), Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0071855 neuropeptide receptor binding
  • GO BP:  GO:0007218 neuropeptide signaling pathway; GO:0031640 killing of cells of another organism; GO:0042742 defense response to bacterium; GO:0050832 defense response to fungus
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  QWGYGGYGRGYGGYGGYGRGMYGGYGRGMYGGYGRGMYGGYGRGMYGGWGK
  • Length:  51(23-73)
  • Propeptide:  MISTSSILVLVVLLACFMAASAQWGYGGYGRGYGGYGGYGRGMYGGYGRGMYGGYGRGMYGGYGRGMYGGWGK
  • Signal peptide:  MISTSSILVLVVLLACFMAASA
  • Modification:  T7 Tyrosine amide;T17 Tyrosine amide;T25 Tyrosine amide;T33 Tyrosine amide;T41 Tyrosine amide;T49 Tryptophan amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Antimicrobial peptides that have antibacterial activity against the Gram-negative bacteria S.marcescens. Has antifungal activity against D.coniospora. May play a role in response to physical injury and osmotic stress
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-O44664-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    AF-O44664-F1.pdbhor000032_AF2.pdbhor000032_ESM.pdb

    Please select some value
    Remove Label
    Add Label

    Please select some value
    Remove Label
    Add Label

    Please select some value
    Remove Label
    Add Label

Physical Information

Mass: 628592 Formula: C243H324N70O65S4
Absent amino acids: ACDEFHILNPSTV Common amino acids: G
pI: 9.94 Basic residues: 6
Polar residues: 38 Hydrophobic residues: 2
Hydrophobicity: -98.24 Boman Index: -4887
Half-Life: 0.8 hour Half-Life Yeast: 10 min
Half-Life E.Coli: >10 hour Aliphatic Index 0
Instability Index: 38.43 Extinction Coefficient cystines: 28880
Absorbance 280nm: 577.6

Literature

  • PubMed ID:  15048112
  • Title:  TLR-independent Control of Innate Immunity in Caenorhabditis Elegans by the TIR Domain Adaptor Protein TIR-1, an Ortholog of Human SARM